PAX3 (NM_181457) Human Mass Spec Standard
CAT＃: PH315181
PAX3 MS Standard C13 and N15-labeled recombinant protein (NP_852122)
View other "PAX3" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 4840.00
Specifications
| Product Data | |
| Description | PAX3 MS Standard C13 and N15-labeled recombinant protein (NP_852122) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215181 |
| Predicted MW | 52.8 kDa |
| Protein Sequence |
>RC215181 representing NM_181457
Red=Cloning site Green=Tags(s) MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPC VISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKD AVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSE PDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGA NQLMAFNHLIPGGFPPTAMPTLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDS SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLE PTTTVSASCSQRLDHMKSLDSLPTSQSYCPPTYSTTGYSMDPVTGYQYGQYGQSKPWTF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_852122 |
| RefSeq Size | 3193 |
| RefSeq ORF | 1437 |
| Synonyms | CDHS; HUP2; WS1; WS3 |
| Locus ID | 5077 |
| Cytogenetics | 2q36.1 |
| Summary | This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini. [provided by RefSeq, Jul 2008] |
| Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405766 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405767 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405768 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405770 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405766 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3 |
CNY 4840.00 |
|
| LY405767 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3D |
CNY 4840.00 |
|
| LY405768 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3E |
CNY 4840.00 |
|
| LY405770 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3G |
CNY 3080.00 |
|
| TP315181 | Purified recombinant protein of Homo sapiens paired box 3 (PAX3), transcript variant PAX3, 20 µg |
CNY 2900.00 |
|
| TP760417 | Purified recombinant protein of Human paired box 3 (PAX3), transcript variant PAX3D, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
