Amyloid Precursor Protein (APP) (NM_201414) Human Mass Spec Standard
CAT＃: PH315147
APP MS Standard C13 and N15-labeled recombinant protein (NP_958817)
View other "Amyloid Precursor Protein" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | APP MS Standard C13 and N15-labeled recombinant protein (NP_958817) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215147 |
| Predicted MW | 76.9 kDa |
| Protein Sequence |
>RC215147 representing NM_201414
Red=Cloning site Green=Tags(s) MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT ESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPK ADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLK KYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDEL LQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTEN EVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL MVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_958817 |
| RefSeq Size | 3416 |
| RefSeq ORF | 2085 |
| Synonyms | AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4 |
| Locus ID | 351 |
| Cytogenetics | 21q21.3 |
| Summary | This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Alzheimer's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404408 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404409 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424694 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427815 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404408 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 |
CNY 3080.00 |
|
| LY404409 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 |
CNY 4840.00 |
|
| LY424694 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 |
CNY 4840.00 |
|
| LY427815 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 |
CNY 3080.00 |
|
| PH309575 | APP MS Standard C13 and N15-labeled recombinant protein (NP_958816) |
CNY 19520.00 |
|
| TP309575 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP315147 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Amyloid Precursor Protein产品
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
