C19orf63 (EMC10) (NM_175063) Human Mass Spec Standard
CAT#: PH315076
C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233)
View other "C19orf63" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215076 |
Predicted MW | 26.6 kDa |
Protein Sequence |
>RC215076 representing NM_175063
Red=Cloning site Green=Tags(s) MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA QKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_778233 |
RefSeq Size | 2740 |
RefSeq ORF | 762 |
Synonyms | C19orf63; HSM1; HSS1 |
Locus ID | 284361 |
Cytogenetics | 19q13.33 |
Summary | Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406303 | EMC10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406303 | Transient overexpression lysate of chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1 |
CNY 3080.00 |
|
TP315076 | Recombinant protein of human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, 20 µg |
CNY 2900.00 |
|
TP700056 | Recombinant protein of secreted form of human HSS1 with DDK/His tag, expressed in human cells, 20ug |
CNY 6650.00 |
|
TP760930 | Purified recombinant protein of Human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它C19orf63产品