CHMP1A (NM_002768) Human Mass Spec Standard
CAT#: PH314991
CHMP1A MS Standard C13 and N15-labeled recombinant protein (NP_002759)
View other "CHMP1A" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CHMP1A MS Standard C13 and N15-labeled recombinant protein (NP_002759) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214991 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC214991 representing NM_002768
Red=Cloning site Green=Tags(s) MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVD AVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLT TPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002759 |
| RefSeq Size | 2474 |
| RefSeq ORF | 588 |
| Synonyms | CHMP1; PCH8; PCOLN3; PRSM1; VPS46-1; VPS46A |
| Locus ID | 5119 |
| Cytogenetics | 16q24.3 |
| Summary | This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419102 | CHMP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421212 | CHMP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419102 | Transient overexpression lysate of chromatin modifying protein 1A (CHMP1A), transcript variant 2 |
CNY 3080.00 |
|
| LY421212 | Transient overexpression lysate of chromatin modifying protein 1A (CHMP1A), transcript variant 1 |
CNY 3080.00 |
|
| TP314991 | Purified recombinant protein of Homo sapiens chromatin modifying protein 1A (CHMP1A), transcript variant 2, 20 µg |
CNY 2900.00 |
