TGF beta 3 (TGFB3) (NM_003239) Human Mass Spec Standard
CAT#: PH314987
TGFB3 MS Standard C13 and N15-labeled recombinant protein (NP_003230)
View other "TGF beta 3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TGFB3 MS Standard C13 and N15-labeled recombinant protein (NP_003230) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214987 |
Predicted MW | 47.33 kDa |
Protein Sequence |
>RC214987 representing NM_003239
Red=Cloning site Green=Tags(s) MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVL ALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVE KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVRE WLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLIL MMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003230 |
RefSeq Size | 2574 |
RefSeq ORF | 1236 |
Synonyms | ARVD; ARVD1; LDS5; RNHF; TGF-beta3 |
Locus ID | 7043 |
Cytogenetics | 14q24.3 |
Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This protein is involved in embryogenesis and cell differentiation, and may play a role in wound healing. Mutations in this gene are a cause of aortic aneurysms and dissections, as well as familial arrhythmogenic right ventricular dysplasia 1. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418815 | TGFB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418815 | Transient overexpression lysate of transforming growth factor, beta 3 (TGFB3) |
CNY 3080.00 |
|
TP314987 | Recombinant protein of human transforming growth factor, beta 3 (TGFB3), 20 µg |
CNY 2900.00 |
|
TP723824 | Purified recombinant protein of Human transforming growth factor, beta 3 (TGFB3) |
CNY 4090.00 |
其它TGF beta 3产品