KIST (UHMK1) (NM_175866) Human Mass Spec Standard
CAT#: PH314962
UHMK1 MS Standard C13 and N15-labeled recombinant protein (NP_787062)
View other "KIST" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UHMK1 MS Standard C13 and N15-labeled recombinant protein (NP_787062) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214962 |
| Predicted MW | 46.4 kDa |
| Protein Sequence |
>RC214962 representing NM_175866
Red=Cloning site Green=Tags(s) MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR DVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQ AGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDL IKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE CQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_787062 |
| RefSeq Size | 2901 |
| RefSeq ORF | 1257 |
| Synonyms | KIS; KIST; P-CIP2 |
| Locus ID | 127933 |
| Cytogenetics | 1q23.3 |
| Summary | The gene encodes a serine/threonine protein kinase that promotes cell cycle progression through G1 by phosphorylation of the cyclin-dependent kinase inhibitor 1B (p27Kip1), which causes nuclear export and degradation. The encoded protein is also thought to function in the adult nervous system and the gene has been associated with schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406187 | UHMK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC432915 | UHMK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406187 | Transient overexpression lysate of U2AF homology motif (UHM) kinase 1 (UHMK1) |
CNY 4840.00 |
|
| LY432915 | Transient overexpression lysate of U2AF homology motif (UHM) kinase 1 (UHMK1), transcript variant 3 |
CNY 3080.00 |
|
| TP314962 | Recombinant protein of human U2AF homology motif (UHM) kinase 1 (UHMK1), 20 µg |
CNY 2900.00 |


