CD247 (NM_198053) Human Mass Spec Standard
CAT＃: PH314725
CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170)
View other "CD247" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214725 |
| Predicted MW | 16.3 kDa |
| Protein Sequence |
>RC214725 representing NM_198053
Red=Cloning site Green=Tags(s) MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYDALHMQALPPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_932170 |
| RefSeq Size | 1677 |
| RefSeq ORF | 489 |
| Synonyms | CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ |
| Locus ID | 919 |
| Cytogenetics | 1q24.2 |
| Summary | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403667 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424538 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403667 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 |
CNY 3080.00 |
|
| LY424538 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 |
CNY 3080.00 |
|
| PH306562 | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) |
CNY 19520.00 |
|
| TP306562 | Recombinant protein of human CD247 molecule (CD247), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP314725 | Recombinant protein of human CD247 molecule (CD247), transcript variant 1, 20 µg |
CNY 2900.00 |
