IFIT3 (NM_001031683) Human Mass Spec Standard
CAT#: PH314701
IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001026853)
View other "IFIT3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001026853) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214701 |
Predicted MW | 56 kDa |
Protein Sequence |
>RC214701 protein sequence
Red=Cloning site Green=Tags(s) MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001026853 |
RefSeq Size | 2467 |
RefSeq ORF | 1470 |
Synonyms | CIG-49; cig41; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G |
Locus ID | 3437 |
Cytogenetics | 10q23.31 |
Summary | IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400593 | IFIT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421898 | IFIT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400593 | Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1 |
CNY 3080.00 |
|
LY421898 | Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2 |
CNY 4840.00 |
|
PH300610 | IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001540) |
CNY 19520.00 |
|
TP300610 | Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP314701 | Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2, 20 µg |
CNY 2900.00 |