NTH1 (NTHL1) (NM_002528) Human Mass Spec Standard
CAT#: PH314598
NTHL1 MS Standard C13 and N15-labeled recombinant protein (NP_002519)
View other "NTH1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | NTHL1 MS Standard C13 and N15-labeled recombinant protein (NP_002519) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214598 |
| Predicted MW | 34.2 kDa |
| Protein Sequence |
>RC214598 representing NM_002528
Red=Cloning site Green=Tags(s) MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEG SDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS QTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAE LVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002519 |
| RefSeq Size | 1097 |
| RefSeq ORF | 936 |
| Synonyms | FAP3; hNTH1; NTH1; OCTS3 |
| Locus ID | 4913 |
| Cytogenetics | 16p13.3 |
| Summary | The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419272 | NTHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419272 | Transient overexpression lysate of nth endonuclease III-like 1 (E. coli) (NTHL1) |
CNY 3080.00 |
|
| TP314598 | Recombinant protein of human nth endonuclease III-like 1 (E. coli) (NTHL1), 20 µg |
CNY 2900.00 |
|
| TP760833 | Purified recombinant protein of Human nth endonuclease III-like 1 (E. coli) (NTHL1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
