CABP2 (NM_016366) Human Mass Spec Standard
CAT#: PH314556
CABP2 MS Standard C13 and N15-labeled recombinant protein (NP_057450)
View other "CABP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | CABP2 MS Standard C13 and N15-labeled recombinant protein (NP_057450) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214556 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC214556 representing NM_016366
Red=Cloning site Green=Tags(s) MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQ LDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELM GPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVD FEEFVRMMSR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057450 |
RefSeq Size | 986 |
RefSeq ORF | 660 |
Synonyms | DFNB93 |
Locus ID | 51475 |
Cytogenetics | 11q13.2 |
Summary | This gene belongs to a subfamily of calcium binding proteins that share similarity to calmodulin. Like calmodulin, these family members can likely stimulate calmodulin-dependent kinase II and the protein phosphatase calcineurin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413985 | CABP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413985 | Transient overexpression lysate of calcium binding protein 2 (CABP2), transcript variant 1 |
CNY 3080.00 |
|
TP314556 | Recombinant protein of human calcium binding protein 2 (CABP2), transcript variant 1, 20 µg |
CNY 2900.00 |