Epigen (EPGN) (NM_001013442) Human Mass Spec Standard
CAT#: PH314501
EPGN MS Standard C13 and N15-labeled recombinant protein (NP_001013460)
View other "Epigen" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | EPGN MS Standard C13 and N15-labeled recombinant protein (NP_001013460) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214501 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC214501 representing NM_001013442
Red=Cloning site Green=Tags(s) MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHEL EKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001013460 |
RefSeq Size | 847 |
RefSeq ORF | 399 |
Synonyms | ALGV3072; EPG; epigen; PRO9904 |
Locus ID | 255324 |
Cytogenetics | 4q13.3 |
Summary | The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422978 | EPGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422978 | Transient overexpression lysate of epithelial mitogen homolog (mouse) (EPGN) |
CNY 3080.00 |
|
TP314501 | Recombinant protein of human epithelial mitogen homolog (mouse) (EPGN), 20 µg |
CNY 2900.00 |