HOMER2 (NM_199331) Human Mass Spec Standard
CAT#: PH314311
HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363)
View other "HOMER2" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214311 |
| Predicted MW | 32.7 kDa |
| Protein Sequence |
>RC214311 representing NM_199331
Red=Cloning site Green=Tags(s) MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQASSVNGTDDEK ASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEI IPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRG LSKLGTDN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_955363 |
| RefSeq Size | 1807 |
| RefSeq ORF | 864 |
| Synonyms | ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2 |
| Locus ID | 9455 |
| Cytogenetics | 15q25.2 |
| Summary | This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401516 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404625 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404626 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404627 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401516 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 |
CNY 3080.00 |
|
| LY404625 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 |
CNY 3080.00 |
|
| LY404626 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 |
CNY 3080.00 |
|
| LY404627 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 |
CNY 3080.00 |
|
| PH304165 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) |
CNY 19520.00 |
|
| PH318155 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955364) |
CNY 14250.00 |
|
| PH323154 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362) |
CNY 14250.00 |
|
| TP304165 | Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP314311 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318155 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP323154 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg |
CNY 2900.00 |
