PDGF AA (PDGFA) (NM_033023) Human Mass Spec Standard
CAT＃: PH314164
PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983)
View other "PDGF AA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214164 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC214164 representing NM_033023
Red=Cloning site Green=Tags(s) MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHA TKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKC QPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_148983 |
| RefSeq Size | 2749 |
| RefSeq ORF | 588 |
| Synonyms | PDGF-A; PDGF1 |
| Locus ID | 5154 |
| Cytogenetics | 7p22.3 |
| Summary | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409784 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419225 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409784 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
CNY 3080.00 |
|
| LY419225 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1 |
CNY 3080.00 |
|
| TP314164 | Purified recombinant protein of Homo sapiens platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP721178 | Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
CNY 1800.00 |
|
| TP721210 | Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
CNY 1800.00 |
其它PDGF AA产品
