PDGF AA (PDGFA) (NM_033023) Human Mass Spec Standard
CAT#: PH314164
PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983)
View other "PDGF AA" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214164 |
Predicted MW | 20.1 kDa |
Protein Sequence |
>RC214164 representing NM_033023
Red=Cloning site Green=Tags(s) MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHA TKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKC QPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_148983 |
RefSeq Size | 2749 |
RefSeq ORF | 588 |
Synonyms | PDGF-A; PDGF1 |
Locus ID | 5154 |
Cytogenetics | 7p22.3 |
Summary | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409784 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419225 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409784 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
CNY 3080.00 |
|
LY419225 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1 |
CNY 3080.00 |
|
TP314164 | Purified recombinant protein of Homo sapiens platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP721178 | Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
CNY 1800.00 |
|
TP721210 | Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
CNY 1800.00 |
其它PDGF AA产品