MEK7 (MAP2K7) (NM_145185) Human Mass Spec Standard
CAT#: PH313868
MAP2K7 MS Standard C13 and N15-labeled recombinant protein (NP_660186)
View other "MEK7" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | MAP2K7 MS Standard C13 and N15-labeled recombinant protein (NP_660186) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC213868 | 
| Predicted MW | 47.3 kDa | 
| Protein Sequence | 
                 >RC213868 representing NM_145185 
Red=Cloning site Green=Tags(s) MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPAR PRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFR KTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRM QGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGC AAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFS GDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_660186 | 
| RefSeq Size | 3386 | 
| RefSeq ORF | 1257 | 
| Synonyms | JNKK2; MAPKK7; MEK; MEK 7; MKK7; PRKMK7; SAPKK-4; SAPKK4 | 
| Locus ID | 5609 | 
| Cytogenetics | 19p13.2 | 
| Summary | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2,MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] | 
| Protein Families | Druggable Genome, Protein Kinase | 
| Protein Pathways | ErbB signaling pathway, Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC408043 | MAP2K7 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY408043 | Transient overexpression lysate of mitogen-activated protein kinase kinase 7 (MAP2K7) | 
                                                     CNY 4840.00  | 
                                            |
| TP313868 | Recombinant protein of human mitogen-activated protein kinase kinase 7 (MAP2K7), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP750167 | Purified recombinant protein of Human mitogen-activated protein kinase kinase 7 (MAP2K7), full length, with C-terminal His tag, expressed in E.coli, 50ug | 
                                                     CNY 1948.00  | 
                                            
