FAM9B (NM_205849) Human Mass Spec Standard
CAT#: PH313736
FAM9B MS Standard C13 and N15-labeled recombinant protein (NP_995321)
View other "FAM9B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAM9B MS Standard C13 and N15-labeled recombinant protein (NP_995321) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213736 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC213736 representing NM_205849
Red=Cloning site Green=Tags(s) MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_995321 |
RefSeq Size | 1339 |
RefSeq ORF | 558 |
Synonyms | TEX39B |
Locus ID | 171483 |
Cytogenetics | Xp22.31 |
Summary | This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404199 | FAM9B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404199 | Transient overexpression lysate of family with sequence similarity 9, member B (FAM9B) |
CNY 3080.00 |
|
TP313736 | Recombinant protein of human family with sequence similarity 9, member B (FAM9B), 20 µg |
CNY 2900.00 |