PPP1R9B (NM_032595) Human Mass Spec Standard
CAT#: PH313696
PPP1R9B MS Standard C13 and N15-labeled recombinant protein (NP_115984)
View other "PPP1R9B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPP1R9B MS Standard C13 and N15-labeled recombinant protein (NP_115984) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213696 |
| Predicted MW | 89.2 kDa |
| Protein Sequence |
>RC213696 representing NM_032595
Red=Cloning site Green=Tags(s) MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSMFLQMGTTAGP SGEAGGGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSERVSRFDSKPAPSAQPAPPPHP PSRLQETRKLFERSAPAAAGGDKEAAARRLLRQERAGLQDRKLDVVVRFNGSTEALDKLDADAVSPTVSQ LSAVFEKADSRTGLHRGPGLPRAAGVPQVNSKLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQ HRVAPARPPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQA APEKEAAAVAPPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEDDEED GEPPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPMAASAEYELEKRVE RLELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGV TQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDE DEELSPTFPGGEMAIEVFELAENEDALSPVDMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKG RWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEI EFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115984 |
| RefSeq Size | 4071 |
| RefSeq ORF | 2451 |
| Synonyms | PPP1R6; PPP1R9; SPINO; Spn |
| Locus ID | 84687 |
| Cytogenetics | 17q21.33 |
| Summary | This gene encodes a scaffold protein that functions as a regulatory subunit of protein phosphatase 1a. Expression of this gene is particularly high in dendritic spines, suggesting that the encoded protein may play a role in receiving signals from the central nervous system. The encoded protein has putative tumor suppressor function and decreased expression has been observed in tumors. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410010 | PPP1R9B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY410010 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 9B (PPP1R9B) |
CNY 4840.00 |
|
| TP313696 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 9B (PPP1R9B), 20 µg |
CNY 2900.00 |
其它PPP1R9B产品


