Glycerol kinase (GK) (NM_000167) Human Mass Spec Standard
CAT#: PH313688
GK MS Standard C13 and N15-labeled recombinant protein (NP_000158)
View other "Glycerol kinase" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GK MS Standard C13 and N15-labeled recombinant protein (NP_000158) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213688 |
| Predicted MW | 57.3 kDa |
| Protein Sequence |
>RC213688 representing NM_000167
Red=Cloning site Green=Tags(s) MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK TCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSK TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYG TGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAK EVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQ INAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000158 |
| RefSeq Size | 3573 |
| RefSeq ORF | 1572 |
| Synonyms | GK1; GKD |
| Locus ID | 2710 |
| Cytogenetics | Xp21.2 |
| Summary | The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404332 | GK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424888 | GK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404332 | Transient overexpression lysate of glycerol kinase (GK), transcript variant 1 |
CNY 3080.00 |
|
| LY424888 | Transient overexpression lysate of glycerol kinase (GK), transcript variant 2 |
CNY 3080.00 |
|
| PH307264 | GK MS Standard C13 and N15-labeled recombinant protein (NP_976325) |
CNY 19520.00 |
|
| TP307264 | Recombinant protein of human glycerol kinase (GK), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313688 | Recombinant protein of human glycerol kinase (GK), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Glycerol kinase产品
