HPS1 (NM_182639) Human Mass Spec Standard
CAT#: PH313679
HPS1 MS Standard C13 and N15-labeled recombinant protein (NP_872577)
View other "HPS1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HPS1 MS Standard C13 and N15-labeled recombinant protein (NP_872577) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213679 |
| Predicted MW | 36.3 kDa |
| Protein Sequence |
>RC213679 representing NM_182639
Red=Cloning site Green=Tags(s) MKCVLVATEGAEVLFYWTDQEFEESLRLKFGQSENEEEELPALEDQLSTLLAPVIISSMTMLEKLSDTYT CFSTENGNFLYVLHLFGECLFIAINGDHTESEGDLRRKLYVLKYLFEVHFGLVTVDGHLIRKELRPPDLA QRVQLWEHFQSLLWTYSRLREQEQCFAVEALERLIHPQLCELCIEALERHVIQAVNTSPERGGEEALHAF LLVHSKLLAFYSSHSASSLRPADLLALILLVQDLYPSESTAEDDIQPSPRRARSSQNIPVQQAWSPHSTG PTGGSSAETETDSFSLPEEYFTPAPSPGDQSSGEDRRKAGGNNS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872577 |
| RefSeq Size | 1625 |
| RefSeq ORF | 972 |
| Synonyms | BLOC3S1; HPS |
| Locus ID | 3257 |
| Cytogenetics | 10q24.2 |
| Summary | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is a component of three different protein complexes termed biogenesis of lysosome-related organelles complex (BLOC)-3, BLOC4, and BLOC5. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 1. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on chromosome 22. [provided by RefSeq, Aug 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424869 | HPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY424869 | Transient overexpression lysate of Hermansky-Pudlak syndrome 1 (HPS1), transcript variant 1 |
CNY 4840.00 |
|
| PH319526 | HPS1 MS Standard C13 and N15-labeled recombinant protein (NP_000186) |
CNY 14250.00 |
|
| TP313679 | Recombinant protein of human Hermansky-Pudlak syndrome 1 (HPS1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP319526 | Recombinant protein of human Hermansky-Pudlak syndrome 1 (HPS1), transcript variant 1, 20 µg |
CNY 2900.00 |
