KIR2DS3 (NM_012313) Human Mass Spec Standard
CAT#: PH313617
KIR2DS3 MS Standard C13 and N15-labeled recombinant protein (NP_036445)
View other "KIR2DS3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | KIR2DS3 MS Standard C13 and N15-labeled recombinant protein (NP_036445) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213617 |
Predicted MW | 33.5 kDa |
Protein Sequence |
>RC213617 representing NM_012313
Red=Cloning site Green=Tags(s) MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTL RLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVL AGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWS KSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQ GPAGNRTVNREDSDEQDHQEVSYA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036445 |
RefSeq Size | 1113 |
RefSeq ORF | 912 |
Synonyms | NKAT7 |
Locus ID | 3808 |
Cytogenetics | 19q13.4 |
Summary | Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Antigen processing and presentation, Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415837 | KIR2DS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415837 | Transient overexpression lysate of killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 3 (KIR2DS3) |
CNY 3080.00 |
|
TP313617 | Recombinant protein of human killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 3 (KIR2DS3), 20 µg |
CNY 2900.00 |
其它KIR2DS3产品