TBL1 (TBL1X) (NM_005647) Human Mass Spec Standard
CAT#: PH313516
TBL1X MS Standard C13 and N15-labeled recombinant protein (NP_005638)
View other "TBL1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TBL1X MS Standard C13 and N15-labeled recombinant protein (NP_005638) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213516 |
| Predicted MW | 62.3 kDa |
| Protein Sequence |
>RC213516 representing NM_005647
Red=Cloning site Green=Tags(s) MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVNFLVYRYLQES GFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMP DVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEENRAHSVNNHAK PMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIRE GGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVD KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKW DPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLW DIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDK VGASASDGSVCVLDLRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005638 |
| RefSeq Size | 5886 |
| RefSeq ORF | 1731 |
| Synonyms | CHNG8; EBI; SMAP55; TBL1 |
| Locus ID | 6907 |
| Cytogenetics | Xp22.31-p22.2 |
| Summary | The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. [provided by RefSeq, Nov 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417178 | TBL1X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427964 | TBL1X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417178 | Transient overexpression lysate of transducin (beta)-like 1X-linked (TBL1X), transcript variant 1 |
CNY 4840.00 |
|
| LY427964 | Transient overexpression lysate of transducin (beta)-like 1X-linked (TBL1X), transcript variant 2 |
CNY 3080.00 |
|
| TP313516 | Recombinant protein of human transducin (beta)-like 1X-linked (TBL1X), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP750166 | Purified recombinant protein of Human transducin (beta)-like 1X-linked (TBL1X), transcript variant 1, full length, Tag free, expressed in E.coli, 50ug |
CNY 1948.00 |
|
| TP760753 | Purified recombinant protein of Human transducin (beta)-like 1X-linked (TBL1X), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
