KCNQ4 (NM_172163) Human Mass Spec Standard
CAT#: PH313421
KCNQ4 MS Standard C13 and N15-labeled recombinant protein (NP_751895)
View other "KCNQ4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | KCNQ4 MS Standard C13 and N15-labeled recombinant protein (NP_751895) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213421 |
| Predicted MW | 71 kDa |
| Protein Sequence |
>RC213421 representing NM_172163
Red=Cloning site Green=Tags(s) MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACG QRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMI VVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQ ILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTIT LTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAW RLYSTDMSRAYLTATWYYYDSILPSFSSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEAT SPTKVQKSWSFNDRTRFRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDIMPAVKTVIRSIRILKFLV AKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEIS MMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTL SISRSVSTNMD TRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_751895 |
| RefSeq Size | 2173 |
| RefSeq ORF | 1923 |
| Synonyms | DFNA2; DFNA2A; KV7.4 |
| Locus ID | 9132 |
| Cytogenetics | 1p34.2 |
| Summary | The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406774 | KCNQ4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC417828 | KCNQ4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY406774 | Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2 |
CNY 4840.00 |
|
| LY417828 | Transient overexpression lysate of potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 1 |
CNY 4840.00 |
|
| TP313421 | Recombinant protein of human potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2, 20 µg |
CNY 2900.00 |
