DTX2 (NM_001102595) Human Mass Spec Standard
CAT#: PH313418
DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065)
View other "DTX2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213418 |
| Predicted MW | 67.3 kDa |
| Protein Sequence |
>RC213418 protein sequence
Red=Cloning site Green=Tags(s) MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKEATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001096065 |
| RefSeq Size | 2550 |
| RefSeq ORF | 1866 |
| Synonyms | RNF58 |
| Locus ID | 113878 |
| Cytogenetics | 7q11.23 |
| Summary | DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Notch signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412251 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420163 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420164 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420165 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY412251 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 |
CNY 3080.00 |
|
| LY420163 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 |
CNY 4840.00 |
|
| LY420164 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 |
CNY 4840.00 |
|
| LY420165 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 |
CNY 4840.00 |
|
| PH303717 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943) |
CNY 19520.00 |
|
| PH312997 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096064) |
CNY 14250.00 |
|
| TP303717 | Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312997 | Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313418 | Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 3, 20 µg |
CNY 2900.00 |
