CTSA (NM_000308) Human Mass Spec Standard
CAT#: PH313409
CTSA MS Standard C13 and N15-labeled recombinant protein (NP_000299)
View other "CTSA" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CTSA MS Standard C13 and N15-labeled recombinant protein (NP_000299) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213409 |
| Predicted MW | 56.12 kDa |
| Protein Sequence |
>RC213409 representing NM_000308
Red=Cloning site Green=Tags(s) MTSSPRAPPGEQGRGGAEMIRAAPPPLFLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGY LKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANV LYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQ DPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEV ARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTN TTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMAC NFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSR FLNKQPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000299 |
| RefSeq Size | 2254 |
| RefSeq ORF | 1491 |
| Synonyms | GLB2; GSL; NGBE; PPCA; PPGB |
| Locus ID | 5476 |
| Cytogenetics | 20q13.12 |
| Summary | This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis. [provided by RefSeq, Nov 2015] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Renin-angiotensin system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424807 | CTSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC433152 | CTSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424807 | Transient overexpression lysate of cathepsin A (CTSA), transcript variant 1 |
CNY 4840.00 |
|
| LY433152 | Transient overexpression lysate of cathepsin A (CTSA), transcript variant 3 |
CNY 3080.00 |
|
| TP313409 | Recombinant protein of human cathepsin A (CTSA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP721221 | Purified recombinant protein of Human cathepsin A (CTSA), transcript variant 1 |
CNY 1800.00 |
