CTBP2 (NM_001083914) Human Mass Spec Standard
CAT#: PH313339
CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383)
View other "CTBP2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213339 |
| Predicted MW | 48.8 kDa |
| Protein Sequence |
>RC213339 representing NM_001083914
Red=Cloning site Green=Tags(s) MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV AHPSQAPSPNQPTKHGDNREHPNEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001077383 |
| RefSeq Size | 3441 |
| RefSeq ORF | 1335 |
| Locus ID | 1488 |
| Cytogenetics | 10q26.13 |
| Summary | This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2014] |
| Protein Families | Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway |
| Protein Pathways | Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420003 | CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421253 | CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY420003 | Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 1 |
CNY 4840.00 |
|
| LY421253 | Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 3 |
CNY 4840.00 |
|
| PH324861 | CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001320) |
CNY 19520.00 |
|
| TP313339 | Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP324861 | Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 1, 20 µg |
CNY 2900.00 |


