LHPP (NM_022126) Human Mass Spec Standard
CAT#: PH313279
LHPP MS Standard C13 and N15-labeled recombinant protein (NP_071409)
View other "LHPP" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LHPP MS Standard C13 and N15-labeled recombinant protein (NP_071409) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213279 |
| Predicted MW | 29.2 kDa |
| Protein Sequence |
>RC213279 protein sequence
Red=Cloning site Green=Tags(s) MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQR LGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQ VLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAV MIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071409 |
| RefSeq Size | 1703 |
| RefSeq ORF | 810 |
| Synonyms | HDHD2B |
| Locus ID | 64077 |
| Cytogenetics | 10q26.13 |
| Summary | Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Oxidative phosphorylation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411763 | LHPP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432687 | LHPP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411763 | Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1 |
CNY 3080.00 |
|
| LY432687 | Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2 |
CNY 3080.00 |
|
| TP313279 | Recombinant protein of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), 20 µg |
CNY 2900.00 |
