SEPTIN4 (NM_004574) Human Mass Spec Standard
CAT#: PH313106
SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_004565)
View other "SEPTIN4" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_004565) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213106 |
Predicted MW | 54.9 kDa |
Protein Sequence |
>RC213106 representing NM_004574
Red=Cloning site Green=Tags(s) MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPD LYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVK KGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTP GFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQ RVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSN TVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVV KERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004565 |
RefSeq Size | 1767 |
RefSeq ORF | 1434 |
Synonyms | ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4 |
Locus ID | 5414 |
Cytogenetics | 17q22 |
Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer. [provided by RefSeq, Nov 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401449 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC403307 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403308 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434256 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401449 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 1 |
CNY 4840.00 |
|
LY403307 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 2 |
CNY 3080.00 |
|
LY403308 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 3 |
CNY 3080.00 |
|
LY434256 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 4 |
CNY 3080.00 |
|
PH315054 | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_536340) |
CNY 19520.00 |
|
TP313106 | Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP315054 | Recombinant protein of human septin 4 (SEPT4), transcript variant 2, 20 µg |
CNY 2900.00 |
其它SEPTIN4产品