Factor XI (F11) (NM_000128) Human Mass Spec Standard
CAT#: PH313056
F11 MS Standard C13 and N15-labeled recombinant protein (NP_000119)
View other "Factor XI" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | F11 MS Standard C13 and N15-labeled recombinant protein (NP_000119) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213056 |
| Predicted MW | 69.9 kDa |
| Protein Sequence |
>RC213056 representing NM_000128
Red=Cloning site Green=Tags(s) MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDP TRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERC TDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVF ADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSL QSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKL SSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTV NYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMIC AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000119 |
| RefSeq Size | 2217 |
| RefSeq ORF | 1875 |
| Synonyms | FXI; PTA |
| Locus ID | 2160 |
| Cytogenetics | 4q35.2 |
| Summary | This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400043 | F11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400043 | Transient overexpression lysate of coagulation factor XI (F11) |
CNY 4840.00 |
|
| TP313056 | Recombinant protein of human coagulation factor XI (F11), 20 µg |
CNY 2900.00 |
|
| TP509529 | Purified recombinant protein of Mouse coagulation factor XI (F11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
CNY 2900.00 |
其它Factor XI产品
