DPM3 (NM_018973) Human Mass Spec Standard
CAT#: PH312952
DPM3 MS Standard C13 and N15-labeled recombinant protein (NP_061846)
View other "DPM3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | DPM3 MS Standard C13 and N15-labeled recombinant protein (NP_061846) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212952 |
| Predicted MW | 13.3 kDa |
| Protein Sequence |
>RC212952 protein sequence
Red=Cloning site Green=Tags(s) MLSVGGLRLSLVRFSFLLLRGALLPSLAVTMTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWP LPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061846 |
| RefSeq Size | 532 |
| RefSeq ORF | 366 |
| Synonyms | CDG1O; MDDGB15; MDDGC15 |
| Locus ID | 54344 |
| Cytogenetics | 1q22 |
| Summary | Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a subunit of dolichyl-phosphate mannosyltransferase and acts as a stabilizer subunit of the dolichyl-phosphate mannosyltransferase complex. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412819 | DPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412819 | Transient overexpression lysate of dolichyl-phosphate mannosyltransferase polypeptide 3 (DPM3), transcript variant 1 |
CNY 3080.00 |
|
| TP312952 | Recombinant protein of human dolichyl-phosphate mannosyltransferase polypeptide 3 (DPM3), transcript variant 1, 20 µg |
CNY 2900.00 |
