C1ORF151 (MINOS1) (NM_001032363) Human Mass Spec Standard
CAT#: PH312930
C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535)
View other "C1ORF151" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212930 |
| Predicted MW | 8.8 kDa |
| Protein Sequence |
>RC212930 protein sequence
Red=Cloning site Green=Tags(s) MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG KYVKEQEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001027535 |
| RefSeq Size | 3726 |
| RefSeq ORF | 234 |
| Synonyms | C1orf151; Mic10; MINOS1; MIO10 |
| Locus ID | 440574 |
| Cytogenetics | 1p36.13 |
| Summary | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422307 | MINOS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422307 | Transient overexpression lysate of chromosome 1 open reading frame 151 (C1orf151) |
CNY 3080.00 |
|
| TP312930 | Recombinant protein of human chromosome 1 open reading frame 151 (C1orf151), 20 µg |
CNY 2900.00 |
其它C1ORF151产品
