PCPTP1 (PTPRR) (NM_002849) Human Mass Spec Standard
CAT#: PH312896
PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_002840)
View other "PCPTP1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_002840) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212896 |
| Predicted MW | 73.86 kDa |
| Protein Sequence |
>RC212896 representing NM_002849
Red=Cloning site Green=Tags(s) MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSS EAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGV AAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEK NVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPAL SEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIRATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSL GNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVM ITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDS AQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGM VQTSEQYEFVHHALCLYESRLSAETVQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002840 |
| RefSeq Size | 3492 |
| RefSeq ORF | 1971 |
| Synonyms | EC-PTP; PCPTP1; PTP-SL; PTPBR7; PTPRQ |
| Locus ID | 5801 |
| Cytogenetics | 12q15 |
| Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. Silencing of this gene has been associated with colorectal cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares a symbol (PTPRQ) with another gene, protein tyrosine phosphatase, receptor type, Q (GeneID 374462), which is also located on chromosome 12. [provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome, Phosphatase, Transmembrane |
| Protein Pathways | MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408898 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419077 | PTPRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408898 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2 |
CNY 3080.00 |
|
| LY419077 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1 |
CNY 4840.00 |
|
| PH311122 | PTPRR MS Standard C13 and N15-labeled recombinant protein (NP_570897) |
CNY 19520.00 |
|
| TP311122 | Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312896 | Recombinant protein of human protein tyrosine phosphatase, receptor type, R (PTPRR), transcript variant 1, 20 µg |
CNY 2900.00 |
