RASSF7 (NM_003475) Human Mass Spec Standard
CAT#: PH312844
RASSF7 MS Standard C13 and N15-labeled recombinant protein (NP_003466)
View other "RASSF7" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | RASSF7 MS Standard C13 and N15-labeled recombinant protein (NP_003466) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212844 |
| Predicted MW | 39.8 kDa |
| Protein Sequence |
>RC212844 representing NM_003475
Red=Cloning site Green=Tags(s) MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA ELLEVAAAPAPEWCPLAAQPQAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003466 |
| RefSeq Size | 1539 |
| RefSeq ORF | 1119 |
| Synonyms | C11orf13; CFAP88; FAP88; HRAS1; HRC1 |
| Locus ID | 8045 |
| Cytogenetics | 11p15.5 |
| Summary | Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via the ubiquitin-proteasome pathway. Required for the activation of AURKB and chromosomal congression during mitosis where it stimulates microtubule polymerization.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418659 | RASSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428453 | RASSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418659 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1 |
CNY 3080.00 |
|
| LY428453 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 2 |
CNY 3080.00 |
|
| TP312844 | Recombinant protein of human Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 (RASSF7), transcript variant 1, 20 µg |
CNY 2900.00 |
