Nebulette (NEBL) (NM_213569) Human Mass Spec Standard
CAT#: PH312733
NEBL MS Standard C13 and N15-labeled recombinant protein (NP_998734)
View other "Nebulette" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | NEBL MS Standard C13 and N15-labeled recombinant protein (NP_998734) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212733 |
| Predicted MW | 31 kDa |
| Protein Sequence |
>RC212733 representing NM_213569
Red=Cloning site Green=Tags(s) MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQSFTTVADTPE NLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNVKYHEDFEKTKGRGFTPVVDD PVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSP NLRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_998734 |
| RefSeq Size | 1245 |
| RefSeq ORF | 810 |
| Synonyms | bA165O3.1; C10orf113; LASP2; LNEBL |
| Locus ID | 10529 |
| Cytogenetics | 10p12.31 |
| Summary | This gene encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403905 | NEBL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403905 | Transient overexpression lysate of nebulette (NEBL), transcript variant 2 |
CNY 3080.00 |
|
| TP312733 | Recombinant protein of human nebulette (NEBL), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Nebulette产品

