UBE2L6 (NM_004223) Human Mass Spec Standard
CAT#: PH312405
UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_004214)
View other "UBE2L6" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_004214) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212405 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC212405 representing NM_004223
Red=Cloning site Green=Tags(s) MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA EEFTLRFGVDRPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004214 |
RefSeq Size | 1260 |
RefSeq ORF | 459 |
Synonyms | RIG-B; UBCH8 |
Locus ID | 9246 |
Cytogenetics | 11q12.1 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Protein Pathways | Parkinson's disease, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401353 | UBE2L6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404883 | UBE2L6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401353 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 1 |
CNY 3080.00 |
|
LY404883 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2 |
CNY 3080.00 |
|
PH307106 | UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_937826) |
CNY 19520.00 |
|
TP307106 | Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP312405 | Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720968 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2 |
CNY 1800.00 |