IL20 (NM_018724) Human Mass Spec Standard
CAT#: PH312397
IL20 MS Standard C13 and N15-labeled recombinant protein (NP_061194)
View other "IL20" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | IL20 MS Standard C13 and N15-labeled recombinant protein (NP_061194) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212397 |
Predicted MW | 20.1 kDa |
Protein Sequence |
>RC212397 protein sequence
Red=Cloning site Green=Tags(s) MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061194 |
RefSeq Size | 1252 |
RefSeq ORF | 528 |
Synonyms | IL-20; IL10D; ZCYTO10 |
Locus ID | 50604 |
Cytogenetics | 1q32.1 |
Summary | The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412869 | IL20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412869 | Transient overexpression lysate of interleukin 20 (IL20) |
CNY 3080.00 |
|
TP312397 | Recombinant protein of human interleukin 20 (IL20), 20 µg |
CNY 2900.00 |
|
TP720126 | Recombinant protein of human interleukin 20 (IL20) |
CNY 1800.00 |