AMMECR1 (NM_015365) Human Mass Spec Standard
CAT#: PH312378
AMMECR1 MS Standard C13 and N15-labeled recombinant protein (NP_056180)
View other "AMMECR1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | AMMECR1 MS Standard C13 and N15-labeled recombinant protein (NP_056180) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212378 |
Predicted MW | 35.3 kDa |
Protein Sequence |
>RC212378 representing NM_015365
Red=Cloning site Green=Tags(s) MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTL SPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYC HLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDEL PRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGY KAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056180 |
RefSeq Size | 5431 |
RefSeq ORF | 999 |
Synonyms | AMMERC1; MFHIEN |
Locus ID | 9949 |
Cytogenetics | Xq23 |
Summary | The exact function of this gene is not known, however, submicroscopic deletion of the X chromosome including this gene, COL4A5, and FACL4 genes, result in a contiguous gene deletion syndrome, the AMME complex (Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414594 | AMMECR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422449 | AMMECR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414594 | Transient overexpression lysate of Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 (AMMECR1), transcript variant 1 |
CNY 3080.00 |
|
LY422449 | Transient overexpression lysate of Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 (AMMECR1), transcript variant 2 |
CNY 3080.00 |
|
TP312378 | Purified recombinant protein of Homo sapiens Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 (AMMECR1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它AMMECR1产品