TAS1R1 (NM_177540) Human Mass Spec Standard
CAT#: PH312370
TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884)
View other "TAS1R1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TAS1R1 MS Standard C13 and N15-labeled recombinant protein (NP_803884) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212370 |
| Predicted MW | 65 kDa |
| Protein Sequence |
>RC212370 representing NM_177540
Red=Cloning site Green=Tags(s) MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVTLCDRSCSFNE HGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLSLPGQHHIELQGDLLHYSPTV LAVIGPDSTNRAATTAALLSPFLVPMLLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFT VLGSSTWSPVQLNINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLY RCQPCGKEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSAGGRL CFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIFKFSTKVPTFYHAWV QNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECTETNSLGFILAFLYNGLLSISAFA CSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTASVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYV ILCRPDLNSTEHFQASIQDYTRRCGST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_803884 |
| RefSeq Size | 1945 |
| RefSeq ORF | 1761 |
| Synonyms | GM148; GPR70; T1R1; TR1 |
| Locus ID | 80835 |
| Cytogenetics | 1p36.31 |
| Summary | The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Taste transduction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403591 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406077 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408549 | TAS1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403591 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 3 |
CNY 4840.00 |
|
| LY406077 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 4 |
CNY 3080.00 |
|
| LY408549 | Transient overexpression lysate of taste receptor, type 1, member 1 (TAS1R1), transcript variant 2 |
CNY 4840.00 |
|
| TP312370 | Recombinant protein of human taste receptor, type 1, member 1 (TAS1R1), transcript variant 3, 20 µg |
CNY 2900.00 |
