CCT6A (NM_001009186) Human Mass Spec Standard
CAT#: PH312330
CCT6A MS Standard C13 and N15-labeled recombinant protein (NP_001009186)
View other "CCT6A" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | CCT6A MS Standard C13 and N15-labeled recombinant protein (NP_001009186) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212330 |
Predicted MW | 53.1 kDa |
Protein Sequence |
>RC212330 representing NM_001009186
Red=Cloning site Green=Tags(s) MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMGLH PRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEP IDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEE REKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLT LACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGL RAVKNAIDDGCVVPGAGAVEVAMAEALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVK IQAEHSESGQLVGVDLNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001009186 |
RefSeq Size | 2547 |
RefSeq ORF | 1458 |
Synonyms | CCT-zeta; CCT-zeta-1; CCT6; Cctz; HTR3; MoDP-2; TCP-1-zeta; TCP20; TCPZ; TTCP20 |
Locus ID | 908 |
Cytogenetics | 7p11.2 |
Summary | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, several pseudogenes of this gene have been located. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419759 | CCT6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC422908 | CCT6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY419759 | Transient overexpression lysate of chaperonin containing TCP1, subunit 6A (zeta 1) (CCT6A), transcript variant 1 |
CNY 4840.00 |
|
LY422908 | Transient overexpression lysate of chaperonin containing TCP1, subunit 6A (zeta 1) (CCT6A), transcript variant 2 |
CNY 4840.00 |
|
TP312330 | Purified recombinant protein of Homo sapiens chaperonin containing TCP1, subunit 6A (zeta 1) (CCT6A), transcript variant 2, 20 µg |
CNY 2900.00 |