CRYL1 (NM_015974) Human Mass Spec Standard
CAT#: PH312304
CRYL1 MS Standard C13 and N15-labeled recombinant protein (NP_057058)
View other "CRYL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CRYL1 MS Standard C13 and N15-labeled recombinant protein (NP_057058) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212304 |
| Predicted MW | 35.2 kDa |
| Protein Sequence |
>RC212304 representing NM_015974
Red=Cloning site Green=Tags(s) MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEE QLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQ CIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLV EEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKV NQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQVQPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057058 |
| RefSeq Size | 1516 |
| RefSeq ORF | 957 |
| Synonyms | GDH; gul3DH; HEL30; lambda-CRY |
| Locus ID | 51084 |
| Cytogenetics | 13q12.11 |
| Summary | The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414265 | CRYL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414265 | Transient overexpression lysate of crystallin, lambda 1 (CRYL1) |
CNY 3080.00 |
|
| TP312304 | Recombinant protein of human crystallin, lambda 1 (CRYL1), 20 µg |
CNY 2900.00 |
