CEACAM7 (NM_006890) Human Mass Spec Standard
CAT#: PH312214
CEACAM7 MS Standard C13 and N15-labeled recombinant protein (NP_008821)
View other "CEACAM7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CEACAM7 MS Standard C13 and N15-labeled recombinant protein (NP_008821) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212214 |
| Predicted MW | 29.2 kDa |
| Protein Sequence |
>RC212214 representing NM_006890
Red=Cloning site Green=Tags(s) MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFY VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008821 |
| RefSeq Size | 2292 |
| RefSeq ORF | 795 |
| Synonyms | CGM2 |
| Locus ID | 1087 |
| Cytogenetics | 19q13.2 |
| Summary | This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictive of rectal cancer recurrence. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402055 | CEACAM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402055 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) |
CNY 3080.00 |
|
| TP312214 | Purified recombinant protein of Homo sapiens carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), 20 µg |
CNY 2900.00 |
其它CEACAM7产品
