SMUG1 (NM_014311) Human Mass Spec Standard
CAT#: PH312141
SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126)
View other "SMUG1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212141 |
| Predicted MW | 29.7 kDa |
| Protein Sequence |
>RC212141 representing NM_014311
Red=Cloning site Green=Tags(s) MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGAR FWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLV VGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055126 |
| RefSeq Size | 1570 |
| RefSeq ORF | 810 |
| Synonyms | FDG; HMUDG; UNG3 |
| Locus ID | 23583 |
| Cytogenetics | 12q13.13 |
| Summary | This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415367 | SMUG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415367 | Transient overexpression lysate of single-strand-selective monofunctional uracil-DNA glycosylase 1 (SMUG1) |
CNY 3080.00 |
|
| TP312141 | Recombinant protein of human single-strand-selective monofunctional uracil-DNA glycosylase 1 (SMUG1), 20 µg |
CNY 2900.00 |


