WBP5 (TCEAL9) (NM_016303) Human Mass Spec Standard
CAT#: PH312064
WBP5 MS Standard C13 and N15-labeled recombinant protein (NP_057387)
View other "WBP5" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | WBP5 MS Standard C13 and N15-labeled recombinant protein (NP_057387) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212064 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC212064 protein sequence
Red=Cloning site Green=Tags(s) MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057387 |
RefSeq Size | 1102 |
RefSeq ORF | 312 |
Synonyms | WBP5; WEX6 |
Locus ID | 51186 |
Cytogenetics | Xq22.2 |
Summary | The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414074 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423688 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423689 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423690 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414074 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 1 |
CNY 3080.00 |
|
LY423688 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 2 |
CNY 3080.00 |
|
LY423689 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 3 |
CNY 3080.00 |
|
LY423690 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 4 |
CNY 3080.00 |
|
TP312064 | Recombinant protein of human WW domain binding protein 5 (WBP5), transcript variant 1, 20 µg |
CNY 2900.00 |