ISCU (NM_014301) Human Mass Spec Standard
CAT#: PH312031
ISCU MS Standard C13 and N15-labeled recombinant protein (NP_055116)
View other "ISCU" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ISCU MS Standard C13 and N15-labeled recombinant protein (NP_055116) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212031 |
| Predicted MW | 15.1 kDa |
| Protein Sequence |
>RC212031 representing NM_014301
Red=Cloning site Green=Tags(s) MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGC GSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAE KK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055116 |
| RefSeq Size | 1086 |
| RefSeq ORF | 426 |
| Synonyms | 2310020H20Rik; HML; hnifU; ISU2; NIFU; NIFUN |
| Locus ID | 23479 |
| Cytogenetics | 12q23.3 |
| Summary | This gene encodes a component of the iron-sulfur (Fe-S) cluster scaffold. Fe-S clusters are cofactors that play a role in the function of a diverse set of enzymes, including those that regulate metabolism, iron homeostasis, and oxidative stress response. Alternative splicing results in transcript variants encoding different protein isoforms that localize either to the cytosol or to the mitochondrion. Mutations in this gene have been found in patients with hereditary myopathy with lactic acidosis. A disease-associated mutation in an intron may activate a cryptic splice site, resulting in the production of a splice variant encoding a putatively non-functional protein. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Feb 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403910 | ISCU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415371 | ISCU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403910 | Transient overexpression lysate of iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY415371 | Transient overexpression lysate of iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| TP312031 | Recombinant protein of human iron-sulfur cluster scaffold homolog (E. coli) (ISCU), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
