C17orf85 (NCBP3) (NM_018553) Human Mass Spec Standard
CAT#: PH312022
C17orf85 MS Standard C13 and N15-labeled recombinant protein (NP_061023)
View other "C17orf85" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | C17orf85 MS Standard C13 and N15-labeled recombinant protein (NP_061023) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212022 |
| Predicted MW | 38.7 kDa |
| Protein Sequence |
>RC212022 representing NM_018553
Red=Cloning site Green=Tags(s) MKYGNPNYGGMKGILSNSWKRRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEE EEEEEEEEEDQDMDADDRVVVEYHEELPALKQPRERSASRRSSASSSDSDEMDYDLELKMISTPSPKKSM KMTMYADEVESQLKNIRNSMRADSVSSSNIKNRIGNKLPPEKFADVRHLLDEKRQHSRPRPPVSSTKSDI RQRLGKRPHSPEKAFSSNPVVRREPSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNT KKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSRLDNLPSLQIEVSRESSSGSEAES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061023 |
| RefSeq Size | 2709 |
| RefSeq ORF | 1020 |
| Synonyms | ELG; HSA277841 |
| Locus ID | 55421 |
| Cytogenetics | 17p13.2 |
| Summary | Associates with NCBP1/CBP80 to form an alternative cap-binding complex (CBC) which plays a key role in mRNA export. NCBP3 serves as adapter protein linking the capped RNAs (m7GpppG-capped RNA) to NCBP1/CBP80. Unlike the conventional CBC with NCBP2 which binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus, the alternative CBC with NCBP3 does not bind snRNA and associates only with mRNA thereby playing a role in only mRNA export. The alternative CBC is particularly important in cellular stress situations such as virus infections and the NCBP3 activity is critical to inhibit virus growth (PubMed:26382858).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413006 | C17orf85 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413006 | Transient overexpression lysate of chromosome 17 open reading frame 85 (C17orf85), transcript variant 2 |
CNY 3080.00 |
|
| TP312022 | Recombinant protein of human chromosome 17 open reading frame 85 (C17orf85), transcript variant 2, 20 µg |
CNY 2900.00 |
其它C17orf85产品
