RABL2A (NM_007082) Human Mass Spec Standard
CAT#: PH311854
RABL2A MS Standard C13 and N15-labeled recombinant protein (NP_009013)
View other "RABL2A" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | RABL2A MS Standard C13 and N15-labeled recombinant protein (NP_009013) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211854 |
| Predicted MW | 26.2 kDa |
| Protein Sequence |
>RC211854 protein sequence
Red=Cloning site Green=Tags(s) MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTI LVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADIN VTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPD QEQSSSIETPSEEAASPHS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009013 |
| RefSeq Size | 1143 |
| RefSeq ORF | 687 |
| Locus ID | 11159 |
| Cytogenetics | 2q14.1 |
| Summary | This gene is a member of the RAB gene family which belongs to the RAS GTPase superfamily. The proteins in the family of RAS-related signaling molecules are small GTP-binding proteins that play important roles in the regulation of exocytotic and endocytotic pathways. This gene maps to the site of an ancestral telomere fusion event and may be a subtelomeric gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415601 | RABL2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416219 | RABL2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415601 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 1 |
CNY 3080.00 |
|
| LY416219 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 2 |
CNY 3080.00 |
|
| TP311854 | Recombinant protein of human RAB, member of RAS oncogene family-like 2A (RABL2A), transcript variant 2, 20 µg |
CNY 2900.00 |
