MARCHF8 (NM_001002265) Human Mass Spec Standard
CAT#: PH311771
MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002265)
View other "MARCH8" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002265) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211771 |
Predicted MW | 32.8 kDa |
Protein Sequence |
>RC211771 representing NM_001002265
Red=Cloning site Green=Tags(s) MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRT SITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLR KWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTG GLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTE PEDTGAEIIHV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002265 |
RefSeq Size | 2604 |
RefSeq ORF | 873 |
Synonyms | c-MIR; MARCH-VIII; MIR; RNF178 |
Locus ID | 220972 |
Cytogenetics | 10q11.21-q11.22 |
Summary | MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408083 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424197 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424198 | 42071 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408083 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8 |
CNY 3080.00 |
|
LY424197 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6 |
CNY 3080.00 |
|
LY424198 | Transient overexpression lysate of membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7 |
CNY 3080.00 |
|
PH305477 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_001002266) |
CNY 19520.00 |
|
PH309891 | MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_659458) |
CNY 19520.00 |
|
TP305477 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 7, 20 µg |
CNY 2900.00 |
|
TP309891 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 8, 20 µg |
CNY 2900.00 |
|
TP311771 | Recombinant protein of human membrane-associated ring finger (C3HC4) 8 (MARCH8), transcript variant 6, 20 µg |
CNY 2900.00 |