CYP11A1 (NM_001099773) Human Mass Spec Standard
CAT#: PH311728
CYP11A1 MS Standard C13 and N15-labeled recombinant protein (NP_001093243)
View other "CYP11A1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | CYP11A1 MS Standard C13 and N15-labeled recombinant protein (NP_001093243) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211728 |
Predicted MW | 42.6 kDa |
Protein Sequence |
>RC211728 representing NM_001099773
Red=Cloning site Green=Tags(s) MAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNP EAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDY RGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMA TMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPT RWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPIS FTFWPFNQEATQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001093243 |
RefSeq Size | 2010 |
RefSeq ORF | 1089 |
Synonyms | CYP11A; CYPXIA1; P450SCC |
Locus ID | 1583 |
Cytogenetics | 15q24.1 |
Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, P450 |
Protein Pathways | C21-Steroid hormone metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424523 | CYP11A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424523 | Transient overexpression lysate of cytochrome P450, family 11, subfamily A, polypeptide 1 (CYP11A1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
TP311728 | Purified recombinant protein of Homo sapiens cytochrome P450, family 11, subfamily A, polypeptide 1 (CYP11A1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它CYP11A1产品