ATP5F1D (NM_001687) Human Mass Spec Standard
CAT#: PH311715
ATP5D MS Standard C13 and N15-labeled recombinant protein (NP_001678)
View other "ATP5F1D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | ATP5D MS Standard C13 and N15-labeled recombinant protein (NP_001678) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211715 |
| Predicted MW | 17.49 kDa |
| Protein Sequence |
>RC211715 representing NM_001687
Red=Cloning site Green=Tags(s) MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGIL AAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAE LVGTADEATRAEIQIRIEANEALVKALE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001678 |
| RefSeq Size | 1005 |
| RefSeq ORF | 504 |
| Synonyms | ATP5D; MC5DN5 |
| Locus ID | 513 |
| Cytogenetics | 19p13.3 |
| Summary | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419790 | ATP5D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424304 | ATP5D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419790 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY424304 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| PH301157 | ATP5D MS Standard C13 and N15-labeled recombinant protein (NP_001001975) |
CNY 14250.00 |
|
| TP301157 | Purified recombinant protein of Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP311715 | Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
其它ATP5F1D产品


