SLURP2 (NM_177458) Human Mass Spec Standard
CAT#: PH311711
LYNX1 MS Standard C13 and N15-labeled recombinant protein (NP_803253)
View other "SLURP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LYNX1 MS Standard C13 and N15-labeled recombinant protein (NP_803253) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211711 |
Predicted MW | 10 kDa |
Protein Sequence |
>RC211711 representing NM_177458
Red=Cloning site Green=Tags(s) MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHI GCPDIPSLGLGPYVSIACCQTSLCNHD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_803253 |
RefSeq Size | 589 |
RefSeq ORF | 291 |
Synonyms | SLURP-2 |
Locus ID | 432355 |
Cytogenetics | 8q24.3 |
Summary | This gene encodes a novel, secreted member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This gene is mainly expressed in epithelial cells, including skin and keratinocytes, and is up-regulated in psoriatic skin lesions, suggesting its involvement in the pathophysiology of psoriasis. Alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (LYNX1) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406174 | LYNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406174 | Transient overexpression lysate of Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2 |
CNY 3080.00 |
|
TP311711 | Recombinant protein of human Ly6/neurotoxin 1 (LYNX1), transcript variant SLURP2, 20 µg |
CNY 2900.00 |