HES1 (NM_005524) Human Mass Spec Standard
CAT#: PH311709
HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515)
View other "HES1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211709 |
| Predicted MW | 29.4 kDa |
| Protein Sequence |
>RC211709 representing NM_005524
Red=Cloning site Green=Tags(s) MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005515 |
| RefSeq Size | 1471 |
| RefSeq ORF | 840 |
| Synonyms | bHLHb39; HES-1; HHL; HRY |
| Locus ID | 3280 |
| Cytogenetics | 3q29 |
| Summary | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008] |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transcription Factors |
| Protein Pathways | Maturity onset diabetes of the young, Notch signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417251 | HES1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417251 | Transient overexpression lysate of hairy and enhancer of split 1, (Drosophila) (HES1) |
CNY 3080.00 |
|
| TP311709 | Recombinant protein of human hairy and enhancer of split 1, (Drosophila) (HES1), 20 µg |
CNY 2900.00 |
|
| TP760671 | Purified recombinant protein of Human hairy and enhancer of split 1, (Drosophila) (HES1), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |


