HNF 4 alpha (HNF4A) (NM_001030003) Human Mass Spec Standard
CAT＃: PH311443
HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174)
View other "HNF 4 alpha" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211443 |
| Predicted MW | 48.8 kDa |
| Protein Sequence |
>RC211443 representing NM_001030003
Red=Cloning site Green=Tags(s) MVSVNAPLGAPVESSYDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNH MYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLS RQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGA TKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGL SDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQE MLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMSTPETPQPSPPGGSGSEPYKLLPGA VATIVKPLSAIPQPTITKQEVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001025174 |
| RefSeq Size | 1339 |
| RefSeq ORF | 1326 |
| Synonyms | FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14 |
| Locus ID | 3172 |
| Cytogenetics | 20q13.12 |
| Summary | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Maturity onset diabetes of the young |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400161 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405861 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422283 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422284 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400161 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
CNY 4840.00 |
|
| LY405861 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 |
CNY 4840.00 |
|
| LY422283 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
CNY 4840.00 |
|
| LY422284 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
CNY 3080.00 |
|
| PH314914 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) |
CNY 19520.00 |
|
| PH316588 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) |
CNY 19520.00 |
|
| PH317863 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) |
CNY 19520.00 |
|
| PH317924 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181) |
CNY 19520.00 |
|
| TP311443 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP314914 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316588 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP317863 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317924 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3, 20 µg |
CNY 2900.00 |
其它HNF 4 alpha产品
Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 100 µg
